Recombinant Proteins

Modified or manipulated proteins encoded by recombinant DNA and suitable for a variety of purposes including the modification of gene sequences, mass protein production, and the manufacture of commercial products.

4,996 – 5,010 of 115,752 results

4,996

Invitrogen™ Human E-selectin (CD62E) Recombinant Protein

Recombinant Protein

Pricing & Availability
Specifications

Regulatory Status	RUO
Purity or Quality Grade	>95%, by SDS-PAGE under reducing conditions
Conjugate	Unconjugated
Form	Liquid
Formulation	0.02 M tris HCl with 100 mM NaCl, 1 mM EDTA, 50% glycerol and no preservative; pH 8
Sequence	Amino acids Asn179- Leu557 containing an N-terminal His-tag
Concentration	0.105 mg/mL
For Use With (Application)	Control,Western Blot
Source	E. coli
Name	Human E-selectin (CD62E)
Recombinant	Recombinant

4,997

R&D Systems™ Recombinant Human CD30/TNFRSF8 Fc Alexa Fluor™ 488 Protein

Fc Chimera

Pricing & Availability

4,998

R&D Systems™ Recombinant Human Bcl-2 related protein A1 (aa 1-152)

Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Inhibition Activity

Pricing & Availability

4,999

R&D Systems™ Recombinant Human Serpin F1/PEDF Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability

5,000

Novus Biologicals™ Recombinant Human alpha-Synuclein Monomer Protein (Biologically Active)

Highly purified and high bioactivity. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Conjugate	Unconjugated
Gene Symbol	SNCA
For Use With (Application)	In vitro Assay,In vivo Assay,SDS-PAGE,Western Blot
Source	E.Coli
Name	Human alpha-Synuclein Monomer Protein
Regulatory Status	RUO
Purification Method	>95% pure by SDS-PAGE
Gene Alias	alpha-Synuclein, Lewy body 4, MGC110988, non A-beta component of AD amyloid, Non-A beta component of AD amyloid, non-A4 component of amyloid, Non-A4 component of amyloid precursor, PARK1, PARK4, synuclein, alpha (non A4 component of amyloid precursor)
Product Type	Recombinant Protein
Gene ID (Entrez)	6622
Formulation	PBS
Immunogen	MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA
Cross Reactivity	Human
Recombinant	Recombinant

5,001

Novus Biologicals™ PMVK/phosphomevalonate kinase Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Regulatory Status	RUO
Purification Method	Protein
Purity or Quality Grade	>95%
Conjugate	Unconjugated
Common Name	PMVK/phosphomevalonate kinase
Molecular Weight (g/mol)	24.1kDa
Gene ID (Entrez)	10654
Formulation	Liquid. In 20mM Tris-HCl buffer (pH 7.5) containing 1mM DTT, 10% glycerol, 0.1M NaCl
Immunogen	PMVK, 1- 192 aa. Sequence: MGSSHHHHHHSSGLVPRGSHMAPLGGAPRLVLLFSGKRKSGKDFVTEALQSRLGADVCAVLRLSGPLKEQYAQEHGLNFQRLLDTSTYKEAFRKDMIRWGEEKRQADPGFFCRKIVEGISQPIWLVSDTRRVSDIQWFREAYGAVTQTVRVVALEQSRQQRGWVFTPGVDDAESECGLDNFGDFDWVIENHGVEQRLEEQLENLIEFIRSRL
Storage Requirements	Store at -80°C. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	ELISA,SDS-PAGE
Source	Human

5,002

R&D Systems™ Recombinant Mouse Rae-1 beta Fc Chimera Protein

Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Binding Activity

Pricing & Availability

5,003

R&D Systems™ Recombinant Cynomolgus CD25/IL-2R alpha Fc Protein

Recombinant Protein

Pricing & Availability

5,004

R&D Systems™ Recombinant Human Cochlin Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

5,005

R&D Systems™ AQUApure Di-Ub Chains (K6-linked) Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability

5,006

R&D Systems™ Recombinant SARS-CoV-2 B.1.351 Spike RBD His Protein

Beta Variant (South Africa), K417N, E484K, N501Y

Pricing & Availability

5,007

R&D Systems™ Recombinant Mouse CD300a/LMIR1 Fc Chimera Protein

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability

5,008

R&D Systems™ Recombinant Human Growth Hormone R (GHR) Fc Chimera

Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility. Applications: Bioactivity

Pricing & Availability

5,009

R&D Systems™ Recombinant Human IL-20R alpha Fc Chimera Protein

Extensive quality control produces lot-to-lot consistency that instills confidence in results and ensures reproducibility.

Pricing & Availability
Specifications

Gene Alias	class II cytokine receptor ZCYTOR7, CRF2-8, Cytokine receptor class-II member 8, Cytokine receptor family 2 member 8, FLJ40993, IL-20 R alpha, IL20R alpha, IL-20R1, IL-20R1IL-20 receptor subunit alpha, IL20RA, IL-20RA, IL-20R-alpha, interleukin 20 receptor, alpha, interleukin-20 receptor I, interleukin-20 receptor subunit alpha, ZcytoR7
Conjugate	Unconjugated
Formulation	Lyophilized from a 0.2μm filtered solution in PBS.
Gene ID (Entrez)	53832
Storage Requirements	Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70° C as supplied. 1 month, 2 to 8° C under sterile conditions after reconstitution. 3 months, -20 to -70° C under sterile conditions after reconstitution.

5,010

Novus Biologicals™ Recombinant Human TRBP Protein

Highly purified. Generating reliable and reproducible results.

Pricing & Availability
Specifications

Purity or Quality Grade	>85%, by SDS-PAGE
Conjugate	Unconjugated
Gene Alias	LOQS, RISC-loading complex subunit TARBP2, TAR (HIV) RNA binding protein 2, TAR (HIV) RNA-binding protein 2, TAR (HIV) RNA-binding protein TRBP1, TAR (HIV-1) RNA binding protein 2, TAR RNA binding protein 2, TAR RNA-binding protein 2, trans-activation responsive RNA-binding protein, Trans-activation-responsive RNA-binding protein, TRBP, TRBP1, TRBP2
Common Name	TRBP
Molecular Weight (g/mol)	TMW: 36.9kDa
Gene ID (Entrez)	6895
Formulation	20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol 0.4M UREA
Storage Requirements	Store at 4°C short term. Aliquot and store at −20°C long term. Avoid freeze-thaw cycles.
Concentration	1mg/mL
For Use With (Application)	SDS-PAGE
Recombinant	Recombinant

Prev
1
...
332
333
334
335
...
7,717
Next

Welcome to fishersci.com

Recombinant Proteins

Filtered Search Results

Narrow Results

Novus Biologicals™ Recombinant Human alpha-Synuclein Monomer Protein (Biologically Active) Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ PMVK/phosphomevalonate kinase Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human TRBP Protein Small and Specialty Supplier PartnerSmall and/or specialty supplier based on Federal laws and SBA requirements.Learn More

Novus Biologicals™ Recombinant Human alpha-Synuclein Monomer Protein (Biologically Active)

Novus Biologicals™ PMVK/phosphomevalonate kinase Protein

Novus Biologicals™ Recombinant Human TRBP Protein